GenBank blast output of UN98080
BLASTX 7.6.2 Query= UN98080 /QuerySize=324 (323 letters) Database: GenBank nr; 20,571,509 sequences; 7,061,663,739 total letters Score E Sequences producing significant alignments: (bits) Value gi|255550786|ref|XP_002516441.1| conserved hypothetical protein ... 58 5e-007 gi|225429544|ref|XP_002279406.1| PREDICTED: uncharacterized prot... 54 6e-006 >gi|255550786|ref|XP_002516441.1| conserved hypothetical protein [Ricinus communis] Length = 316 Score = 58 bits (138), Expect = 5e-007 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -1 Query: 197 EDSTTLPSIWTSINNWCTPTILFLFLNFMIATILFTSNL 81 E T++PSIW S+N+W TPT+LFLFLN MI TI TS+L Sbjct: 4 ESVTSIPSIWASMNSWFTPTVLFLFLNLMIGTIYVTSSL 42 >gi|225429544|ref|XP_002279406.1| PREDICTED: uncharacterized protein LOC100249297 [Vitis vinifera] Length = 249 Score = 54 bits (129), Expect = 6e-006 Identities = 23/39 (58%), Positives = 29/39 (74%) Frame = -1 Query: 197 EDSTTLPSIWTSINNWCTPTILFLFLNFMIATILFTSNL 81 E+S ++PSIW S+N+W TP +LFL LN MI TI TS L Sbjct: 3 EESMSIPSIWASMNSWFTPAVLFLLLNLMIGTIFVTSGL 41 Database: GenBank nr Posted date: Thu Sep 27 19:07:00 2012 Number of letters in database: 7,061,663,739 Number of sequences in database: 20,571,509 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,866,242,621,045 Number of Sequences: 20571509 Number of Extensions: 6866242621045 Number of Successful Extensions: 1763222685 Number of sequences better than 0.0: 0 |