SwissProt blast output of UN65481
BLASTX 7.6.2 Query= UN65481 /QuerySize=1126 (1125 letters) Database: Uniprot/SwissProt; 537,505 sequences; 190,795,139 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q56XJ7|Y4276_ARATH Uncharacterized protein At4g22758 OS=Arabi... 52 7e-006 >sp|Q56XJ7|Y4276_ARATH Uncharacterized protein At4g22758 OS=Arabidopsis thaliana GN=At4g22758 PE=2 SV=1 Length = 255 Score = 52 bits (123), Expect = 7e-006 Identities = 29/78 (37%), Positives = 45/78 (57%), Gaps = 2/78 (2%) Frame = -2 Query: 683 SLGPVQVIISPNSSVRDLVADALRQYSKEGRRPILSSLDPSEFSLHYSQFSLQSLEPDDK 504 S GPV+ ++ + +V + + + +Y KEGR P L S F LH S FS+Q LE + Sbjct: 133 SPGPVRAMVKLSCNVEETIKIVVDKYCKEGRTPKLDR--DSAFELHQSHFSIQCLEKREI 190 Query: 503 LIDLGSRNFFLCPKQTAT 450 + +LGSR+F++ K T Sbjct: 191 IGELGSRSFYMRKKAPET 208 Database: Uniprot/SwissProt Posted date: Thu Sep 27 17:53:50 2012 Number of letters in database: 190,795,139 Number of sequences in database: 537,505 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 102,949,728,757 Number of Sequences: 537505 Number of Extensions: 102949728757 Number of Successful Extensions: 585515847 Number of sequences better than 0.0: 0 |