TrEMBL blast output of UN65137
BLASTX 7.6.2 Query= UN65137 /QuerySize=816 (815 letters) Database: Uniprot/TrEMBL; 23,994,583 sequences; 7,812,677,823 total letters Score E Sequences producing significant alignments: (bits) Value tr|I1L670|I1L670_SOYBN Uncharacterized protein OS=Glycine max GN... 57 3e-006 >tr|I1L670|I1L670_SOYBN Uncharacterized protein OS=Glycine max GN=Gma.44779 PE=4 SV=1 Length = 311 Score = 57 bits (137), Expect = 3e-006 Identities = 33/55 (60%), Positives = 36/55 (65%), Gaps = 8/55 (14%) Frame = -3 Query: 159 CLSPLVRGRSPNRLWSMKGKGSDV-------VVPHLSYAKSFVANRSRKLADFGR 16 CLSPLVR SPNR W+ KG ++ PHLS A SF ANRSRKLADFGR Sbjct: 253 CLSPLVRA-SPNRRWNNKGLPPEMAEVRAAAAKPHLSAAASFCANRSRKLADFGR 306 Database: Uniprot/TrEMBL Posted date: Thu Sep 27 19:50:57 2012 Number of letters in database: 7,812,677,823 Number of sequences in database: 23,994,583 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,110,080,768,042 Number of Sequences: 23994583 Number of Extensions: 4110080768042 Number of Successful Extensions: 844267150 Number of sequences better than 0.0: 0 |