Arabidopsis blast output of UN62613
BLASTX 7.6.2 Query= UN62613 /QuerySize=321 (320 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G13570.1 | Symbols: SCL30A | SCL30a; RNA bindi... 74 1e-014 TAIR9_protein||AT1G55310.1 | Symbols: SR33, ATSCL33, SCL33 | SR3... 71 9e-014 TAIR9_protein||AT1G55310.2 | Symbols: SR33, ATSCL33, SCL33 | SR3... 71 9e-014 TAIR9_protein||AT3G55460.1 | Symbols: SCL30 | SCL30; RNA binding... 60 2e-010 TAIR9_protein||AT5G18810.1 | Symbols: SCL28 | SCL28; RNA binding... 58 8e-010 >TAIR9_protein||AT3G13570.1 | Symbols: SCL30A | SCL30a; RNA binding / nucleic acid binding / nucleotide binding | chr3:4429564-4431602 REVERSE Length = 263 Score = 74 bits (180), Expect = 1e-014 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -3 Query: 120 ERDLPTSLLVRNLRLDCRPEDLRRPFGQFGPLKDIYLPRD 1 + DLPTSLLVRNLR DCR EDLRRPF QFGP+KDIYLPRD Sbjct: 32 DSDLPTSLLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRD 71 >TAIR9_protein||AT1G55310.1 | Symbols: SR33, ATSCL33, SCL33 | SR33; RNA binding / protein binding | chr1:20630676-20632695 FORWARD Length = 288 Score = 71 bits (173), Expect = 9e-014 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -3 Query: 117 RDLPTSLLVRNLRLDCRPEDLRRPFGQFGPLKDIYLPRD 1 RDLPTSLLVRNLR DCR EDLR+ F QFGP+KDIYLPRD Sbjct: 32 RDLPTSLLVRNLRHDCRQEDLRKSFEQFGPVKDIYLPRD 70 >TAIR9_protein||AT1G55310.2 | Symbols: SR33, ATSCL33, SCL33 | SR33; RNA binding / protein binding | chr1:20630676-20632567 FORWARD Length = 221 Score = 71 bits (173), Expect = 9e-014 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -3 Query: 117 RDLPTSLLVRNLRLDCRPEDLRRPFGQFGPLKDIYLPRD 1 RDLPTSLLVRNLR DCR EDLR+ F QFGP+KDIYLPRD Sbjct: 32 RDLPTSLLVRNLRHDCRQEDLRKSFEQFGPVKDIYLPRD 70 >TAIR9_protein||AT3G55460.1 | Symbols: SCL30 | SCL30; RNA binding / nucleic acid binding / nucleotide binding | chr3:20561024-20563502 FORWARD Length = 263 Score = 60 bits (144), Expect = 2e-010 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -3 Query: 102 SLLVRNLRLDCRPEDLRRPFGQFGPLKDIYLPRD 1 SLLVRN+ LDCRPE+LR PF +FGP++D+Y+PRD Sbjct: 48 SLLVRNIPLDCRPEELREPFERFGPVRDVYIPRD 81 >TAIR9_protein||AT5G18810.1 | Symbols: SCL28 | SCL28; RNA binding / nucleic acid binding / nucleotide binding | chr5:6268925-6271158 REVERSE Length = 237 Score = 58 bits (139), Expect = 8e-010 Identities = 30/49 (61%), Positives = 34/49 (69%), Gaps = 4/49 (8%) Frame = -3 Query: 135 RGRPVERDL----PTSLLVRNLRLDCRPEDLRRPFGQFGPLKDIYLPRD 1 R RP RD P+ LL+RNL LD RP DLR F +FGPLKDIYLPR+ Sbjct: 33 RERPSSRDHESSGPSGLLIRNLPLDARPNDLRDSFERFGPLKDIYLPRN 81 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,721,504,308 Number of Sequences: 33410 Number of Extensions: 12721504308 Number of Successful Extensions: 549546329 Number of sequences better than 0.0: 0 |