Arabidopsis blast output of UN60876
BLASTX 7.6.2 Query= UN60876 /QuerySize=794 (793 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G50300.1 | Symbols: TAF15 | TAF15 (TBP-associa... 75 3e-014 >TAIR9_protein||AT1G50300.1 | Symbols: TAF15 | TAF15 (TBP-associated factor 15); RNA binding / nucleic acid binding / nucleotide binding / zinc ion binding | chr1:18628818-18631662 REVERSE Length = 373 Score = 75 bits (184), Expect = 3e-014 Identities = 35/54 (64%), Positives = 39/54 (72%) Frame = -3 Query: 680 GNINWAKRLKCNICNTNKPXXXXXXXXXXXXXXYKELDEEELEKTWRRRREAKE 519 GN+NWAKRLKCNICNTNKP YKELDE+ELE+T RRRREA+E Sbjct: 213 GNVNWAKRLKCNICNTNKPGQNEGGVRGGRGGGYKELDEQELEETKRRRREAEE 266 Score = 67 bits (162), Expect = 1e-011 Identities = 31/45 (68%), Positives = 37/45 (82%), Gaps = 1/45 (2%) Frame = -2 Query: 474 QDDGEMYDKFGNLKKKFRVKTQQAEVGQVLPGTGRAGWEVEELGM 340 +DDGEMYD+FGNLKKK+RVKT QA+ + GRAGWEVEELG+ Sbjct: 266 EDDGEMYDEFGNLKKKYRVKTNQADTRPAV-AAGRAGWEVEELGI 309 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 12,275,099,411 Number of Sequences: 33410 Number of Extensions: 12275099411 Number of Successful Extensions: 514364807 Number of sequences better than 0.0: 0 |