Arabidopsis blast output of UN54787
BLASTX 7.6.2 Query= UN54787 /QuerySize=460 (459 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G49050.1 | Symbols: | aspartyl protease famil... 47 5e-006 >TAIR9_protein||AT1G49050.1 | Symbols: | aspartyl protease family protein | chr1:18150638-18153186 FORWARD Length = 584 Score = 47 bits (110), Expect = 5e-006 Identities = 20/37 (54%), Positives = 28/37 (75%) Frame = -2 Query: 350 NDDQDHSHLKGFVIITLPPADNPSLGKTITAFTVSNH 240 +D Q + VIITLPP+D+PS GKTI+AFT+++H Sbjct: 6 HDQQQQQRVHSVVIITLPPSDDPSQGKTISAFTLTDH 42 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,962,529,292 Number of Sequences: 33410 Number of Extensions: 10962529292 Number of Successful Extensions: 458097703 Number of sequences better than 0.0: 0 |