Arabidopsis blast output of UN47287
BLASTX 7.6.2 Query= UN47287 /QuerySize=1282 (1281 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G15340.1 | Symbols: MBD10 | MBD10; DNA binding... 125 7e-029 TAIR9_protein||AT3G15790.1 | Symbols: MBD11, ATMBD11 | MBD11; DN... 116 3e-026 >TAIR9_protein||AT1G15340.1 | Symbols: MBD10 | MBD10; DNA binding / methyl-CpG binding | chr1:5275895-5277474 REVERSE Length = 385 Score = 125 bits (313), Expect = 7e-029 Identities = 57/83 (68%), Positives = 71/83 (85%) Frame = -1 Query: 1179 DDVVSLELPAPEGWKKMCLLKKGGTPGKNETVFTAPTGEEITNKKQLEQYLKSNPGGPKI 1000 D++VS+ELPAP WKK+ K+ GTP K E VF APTGEEI+++KQLEQYLK++PG P I Sbjct: 5 DELVSIELPAPASWKKLFYPKRAGTPRKTEIVFVAPTGEEISSRKQLEQYLKAHPGNPVI 64 Query: 999 SEFDWTSGETPRRSSRISEKVKS 931 SEF+WT+GETPRRSSRIS+KVK+ Sbjct: 65 SEFEWTTGETPRRSSRISQKVKA 87 >TAIR9_protein||AT3G15790.1 | Symbols: MBD11, ATMBD11 | MBD11; DNA binding / methyl-CpG binding | chr3:5343209-5344386 FORWARD Length = 255 Score = 116 bits (290), Expect = 3e-026 Identities = 54/84 (64%), Positives = 67/84 (79%) Frame = -1 Query: 1182 QDDVVSLELPAPEGWKKMCLLKKGGTPGKNETVFTAPTGEEITNKKQLEQYLKSNPGGPK 1003 +++VVS+ELPAP WKK+ K G+ K E VF APTGEEI+N+KQLEQYLKS+PG P Sbjct: 4 EEEVVSVELPAPSSWKKLFYPNKVGSVKKTEVVFVAPTGEEISNRKQLEQYLKSHPGNPA 63 Query: 1002 ISEFDWTSGETPRRSSRISEKVKS 931 I+EFDWT+ TPRRS+RISEK K+ Sbjct: 64 IAEFDWTTSGTPRRSARISEKTKA 87 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,429,481,453 Number of Sequences: 33410 Number of Extensions: 9429481453 Number of Successful Extensions: 386515455 Number of sequences better than 0.0: 0 |