Arabidopsis blast output of UN46172
BLASTX 7.6.2 Query= UN46172 /QuerySize=479 (478 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G03030.1 | Symbols: | kelch repeat-containing... 72 1e-013 >TAIR9_protein||AT4G03030.1 | Symbols: | kelch repeat-containing F-box family protein | chr4:1335942-1337270 REVERSE Length = 443 Score = 72 bits (175), Expect = 1e-013 Identities = 35/88 (39%), Positives = 54/88 (61%), Gaps = 2/88 (2%) Frame = -2 Query: 261 TLGLIPGLPDDLSALILAFIPYSYHGRLRSISKSWKKFFSSRAIHAIRAKHVPLSTK--G 88 +L LIPGL +D+ LIL+F+PY + R++S KSW F SS+ + ++R +T Sbjct: 35 SLTLIPGLSNDVGRLILSFVPYPHISRIKSTCKSWYAFLSSKTLISLRHSRDNSNTNNLS 94 Query: 87 EVLCVFPNDPSVSDFYVFDVRNKAWSCL 4 +LC+FP DPS+S ++FD +W L Sbjct: 95 HLLCIFPQDPSISPPFLFDPVTLSWRSL 122 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,982,156,952 Number of Sequences: 33410 Number of Extensions: 2982156952 Number of Successful Extensions: 83911025 Number of sequences better than 0.0: 0 |