Arabidopsis blast output of UN43548
BLASTX 7.6.2 Query= UN43548 /QuerySize=611 (610 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G11160.1 | Symbols: | translation initiation ... 65 2e-011 >TAIR9_protein||AT4G11160.1 | Symbols: | translation initiation factor IF-2, mitochondrial, putative | chr4:6803846-6806726 FORWARD Length = 744 Score = 65 bits (158), Expect = 2e-011 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = -2 Query: 144 KPPVEAPYVPPRLQKTAKSYSDKTVEIFEGMTTSELAKRCGQYPSTLQ 1 KPPVEAPYVPPRL++ AK KTV+IFEGMT EL+KR G+ + LQ Sbjct: 124 KPPVEAPYVPPRLKRLAKGLPGKTVDIFEGMTLLELSKRTGESVAVLQ 171 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,747,531,335 Number of Sequences: 33410 Number of Extensions: 8747531335 Number of Successful Extensions: 365417718 Number of sequences better than 0.0: 0 |