Arabidopsis blast output of UN40275
BLASTX 7.6.2 Query= UN40275 /QuerySize=305 (304 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G26600.1 | Symbols: | nucleolar protein, puta... 56 4e-009 >TAIR9_protein||AT4G26600.1 | Symbols: | nucleolar protein, putative | chr4:13419629-13423418 FORWARD Length = 672 Score = 56 bits (133), Expect = 4e-009 Identities = 35/99 (35%), Positives = 57/99 (57%), Gaps = 3/99 (3%) Frame = -3 Query: 299 SDTKTPSSRFLIFCSSRKMGVKGGGKKTLQKKKDEFVSKKKNTKKNDILSSSSSEDDEES 120 S+++TP S K K +K KK+ + +S+KK KK ++ S+ E++EE+ Sbjct: 12 SNSQTPPLNKQTKASPLKKAAK--TQKPPLKKQRKCISEKKPLKKPEV-STDEEEEEEEN 68 Query: 119 DIEEQQIESGSDDMSDGEQEQDDDFANDVLQGSDDDDDD 3 + ++ ESGSD SDG++E ++D +D DDDDDD Sbjct: 69 EQSDEGSESGSDLFSDGDEEGNNDSDDDDDDDDDDDDDD 107 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,478,124,716 Number of Sequences: 33410 Number of Extensions: 2478124716 Number of Successful Extensions: 72278587 Number of sequences better than 0.0: 0 |