Arabidopsis blast output of UN36002
BLASTX 7.6.2 Query= UN36002 /QuerySize=481 (480 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G08480.1 | Symbols: MAPKKK9 | MAPKKK9; ATP bin... 57 4e-009 >TAIR9_protein||AT4G08480.1 | Symbols: MAPKKK9 | MAPKKK9; ATP binding / kinase/ protein kinase/ protein serine/threonine kinase | chr4:5388253-5391507 REVERSE Length = 774 Score = 57 bits (137), Expect = 4e-009 Identities = 28/51 (54%), Positives = 37/51 (72%), Gaps = 2/51 (3%) Frame = -2 Query: 260 NQTSFRIKGIDDGEIDFICQTLGLSGPDDFAIPSDEYTSSMFTRHQVRSHD 108 N+TSFR+ G+DDGEID I Q +G+SGP+DFAI SD + + M H+ S D Sbjct: 155 NRTSFRVDGVDDGEIDRIYQYIGVSGPEDFAISSDAWKARM--EHERSSSD 203 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,325,447,419 Number of Sequences: 33410 Number of Extensions: 7325447419 Number of Successful Extensions: 303365063 Number of sequences better than 0.0: 0 |