SwissProt blast output of UN30179
BLASTX 7.6.2 Query= UN30179 /QuerySize=241 (240 letters) Database: Uniprot/SwissProt; 537,505 sequences; 190,795,139 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9LUI1|LRX6_ARATH Leucine-rich repeat extensin-like protein 6... 57 3e-008 sp|Q9T0K5|LRX3_ARATH Leucine-rich repeat extensin-like protein 3... 52 7e-007 sp|Q91Z58|CF132_MOUSE Uncharacterized protein C6orf132 homolog O... 52 9e-007 sp|Q9XIL9|PLRX3_ARATH Pollen-specific leucine-rich repeat extens... 51 2e-006 sp|Q8C4A5|ASXL3_MOUSE Putative Polycomb group protein ASXL3 OS=M... 50 3e-006 sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 50 4e-006 sp|P0C7L0|WIPF3_MOUSE WAS/WASL-interacting protein family member... 50 4e-006 sp|P21260|YPRO_OWEFU Uncharacterized proline-rich protein (Fragm... 49 7e-006 sp|Q9Z0G8|WIPF3_RAT WAS/WASL-interacting protein family member 3... 49 1e-005 >sp|Q9LUI1|LRX6_ARATH Leucine-rich repeat extensin-like protein 6 OS=Arabidopsis thaliana GN=LRX6 PE=2 SV=1 Length = 470 Score = 57 bits (136), Expect = 3e-008 Identities = 26/48 (54%), Positives = 28/48 (58%), Gaps = 4/48 (8%) Frame = -1 Query: 240 PPPPPLPPPPPPPLVLCPPIVAVKPPP----PPRFIYVTNPPTNVYHP 109 PPPPP PPPPPPP PP V PPP PP ++Y PP VY P Sbjct: 389 PPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPP 436 Score = 54 bits (128), Expect = 2e-007 Identities = 22/38 (57%), Positives = 25/38 (65%), Gaps = 4/38 (10%) Frame = -1 Query: 240 PPPPPLPPPPPPPLVLCPPIVAVKPPPPPRFIYVTNPP 127 PPPPP PPPPPPP PP PPPPP ++Y + PP Sbjct: 382 PPPPPPPPPPPPP----PPPPPPPPPPPPPYVYPSPPP 415 >sp|Q9T0K5|LRX3_ARATH Leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana GN=LRX3 PE=1 SV=1 Length = 760 Score = 52 bits (124), Expect = 7e-007 Identities = 27/57 (47%), Positives = 30/57 (52%), Gaps = 9/57 (15%) Frame = -1 Query: 240 PPPPPLPPPPPPPLVLCPPIVAVKPPPPPRFIY------VTNPPTNVYHPFTLQIYS 88 PPPPP PPPPPPP+ PP PPPPP +Y PP VY P +YS Sbjct: 466 PPPPPPPPPPPPPVYSPPP---PSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYS 519 >sp|Q91Z58|CF132_MOUSE Uncharacterized protein C6orf132 homolog OS=Mus musculus PE=1 SV=2 Length = 1206 Score = 52 bits (123), Expect = 9e-007 Identities = 21/44 (47%), Positives = 28/44 (63%) Frame = -1 Query: 240 PPPPPLPPPPPPPLVLCPPIVAVKPPPPPRFIYVTNPPTNVYHP 109 PPPP +PPPPPPPL++ PP PPPP + + +PP+ P Sbjct: 164 PPPPSVPPPPPPPLLVEPPPPPSTAPPPPPPLDILSPPSTPTPP 207 >sp|Q9XIL9|PLRX3_ARATH Pollen-specific leucine-rich repeat extensin-like protein 3 OS=Arabidopsis thaliana GN=PEX3 PE=2 SV=1 Length = 727 Score = 51 bits (120), Expect = 2e-006 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = -1 Query: 240 PPPPPLPPPPPPPLVLCPPIVAVKPPPPPRFIYVTNPPTNVYHP 109 PPPPP+ PPPP + PP V PPPP +Y PP VY P Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSP 536 Score = 49 bits (115), Expect = 7e-006 Identities = 21/44 (47%), Positives = 25/44 (56%) Frame = -1 Query: 240 PPPPPLPPPPPPPLVLCPPIVAVKPPPPPRFIYVTNPPTNVYHP 109 PPP P+ PPPPP+ PP V PPPP +Y PP V+ P Sbjct: 502 PPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSP 545 >sp|Q8C4A5|ASXL3_MOUSE Putative Polycomb group protein ASXL3 OS=Mus musculus GN=Asxl3 PE=2 SV=3 Length = 2259 Score = 50 bits (119), Expect = 3e-006 Identities = 21/29 (72%), Gaps = 5/29 (17%) Frame = -1 Query: 240 PPPPPLPPPPPPPLVLCPPIVAVKPPPPP 154 PPPPP PPPPPPPL L PP PPPPP Sbjct: 2025 PPPPPPPPPPPPPLALPPP-----PPPPP 2048 >sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 Length = 871 Score = 50 bits (117), Expect = 4e-006 Identities = 20/42 (47%), Positives = 23/42 (54%) Frame = -1 Query: 240 PPPPPLPPPPPPPLVLCPPIVAVKPPPPPRFIYVTNPPTNVY 115 P PPP PPPPPP PP +PPPPP NPP ++ Sbjct: 428 PSPPPPPPPPPPSFPPPPPPTGTQPPPPPPGYPAPNPPVGLH 469 >sp|P0C7L0|WIPF3_MOUSE WAS/WASL-interacting protein family member 3 OS=Mus musculus GN=Wipf3 PE=1 SV=1 Length = 485 Score = 50 bits (117), Expect = 4e-006 Identities = 20/29 (68%) Frame = -1 Query: 240 PPPPPLPPPPPPPLVLCPPIVAVKPPPPP 154 PPPPP PPPPPPPL PP PPPPP Sbjct: 8 PPPPPPPPPPPPPLGAPPPPPLGAPPPPP 36 >sp|P21260|YPRO_OWEFU Uncharacterized proline-rich protein (Fragment) OS=Owenia fusiformis PE=4 SV=1 Length = 141 Score = 49 bits (115), Expect = 7e-006 Identities = 20/30 (66%) Frame = -1 Query: 240 PPPPPLPPPPPPPLVLCPPIVAVKPPPPPR 151 PPPPP PPPPPPP PP PPPPPR Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPR 59 >sp|Q9Z0G8|WIPF3_RAT WAS/WASL-interacting protein family member 3 OS=Rattus norvegicus GN=Wipf3 PE=1 SV=1 Length = 485 Score = 49 bits (114), Expect = 1e-005 Identities = 19/29 (65%) Frame = -1 Query: 240 PPPPPLPPPPPPPLVLCPPIVAVKPPPPP 154 PPPPP PPPP P C P AV PPPPP Sbjct: 301 PPPPPPPPPPLPTYASCSPRAAVAPPPPP 329 Database: Uniprot/SwissProt Posted date: Thu Sep 27 17:53:50 2012 Number of letters in database: 190,795,139 Number of sequences in database: 537,505 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,706,940,022 Number of Sequences: 537505 Number of Extensions: 28706940022 Number of Successful Extensions: 120667149 Number of sequences better than 0.0: 0 |