Arabidopsis blast output of UN27851
BLASTX 7.6.2 Query= UN27851 /QuerySize=651 (650 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G27350.1 | Symbols: | FUNCTIONS IN: molecular... 119 2e-027 TAIR9_protein||AT1G27330.1 | Symbols: | FUNCTIONS IN: molecular... 119 2e-027 >TAIR9_protein||AT1G27350.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; CONTAINS InterPro DOMAIN/s: Ribosome associated membrane RAMP4 (InterPro:IPR010580); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G27330.1); Has 267 Blast hits to 267 proteins in 83 species: Archae - 0; Bacteria - 0; Metazoa - 183; Fungi - 0; Plants - 55; Viruses - 0; Other Eukaryotes - 29 (source: NCBI BLink). | chr1:9498319-9499303 REVERSE Length = 69 Score = 119 bits (297), Expect = 2e-027 Identities = 58/69 (84%), Positives = 63/69 (91%) Frame = -1 Query: 473 MTTSKRLADRKVERFEKNIKKRGSVPETTTKKKDSYPVGPIVLGFFIFVVIGSSLFQIIR 294 MTTSKRLADRK+E+F+KNI KRG VPETTTKK YPVGPI+LGFF+FVVIGSSLFQIIR Sbjct: 1 MTTSKRLADRKIEKFDKNILKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIR 60 Query: 293 TATSGGMA* 267 TATSGGMA* Sbjct: 61 TATSGGMA* 69 >TAIR9_protein||AT1G27330.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: response to oxidative stress; LOCATED IN: cellular_component unknown; EXPRESSED IN: male gametophyte, pollen tube; EXPRESSED DURING: L mature pollen stage, M germinated pollen stage; CONTAINS InterPro DOMAIN/s: Ribosome associated membrane RAMP4 (InterPro:IPR010580); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G27350.1); Has 267 Blast hits to 267 proteins in 83 species: Archae - 0; Bacteria - 0; Metazoa - 183; Fungi - 0; Plants - 55; Viruses - 0; Other Eukaryotes - 29 (source: NCBI BLink). | chr1:9493064-9493898 FORWARD Length = 69 Score = 119 bits (297), Expect = 2e-027 Identities = 58/69 (84%), Positives = 63/69 (91%) Frame = -1 Query: 473 MTTSKRLADRKVERFEKNIKKRGSVPETTTKKKDSYPVGPIVLGFFIFVVIGSSLFQIIR 294 MTTSKRLADRK+E+F+KNI KRG VPETTTKK YPVGPI+LGFF+FVVIGSSLFQIIR Sbjct: 1 MTTSKRLADRKIEKFDKNILKRGFVPETTTKKGKDYPVGPILLGFFVFVVIGSSLFQIIR 60 Query: 293 TATSGGMA* 267 TATSGGMA* Sbjct: 61 TATSGGMA* 69 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,015,511,678 Number of Sequences: 33410 Number of Extensions: 6015511678 Number of Successful Extensions: 246324550 Number of sequences better than 0.0: 0 |