SwissProt blast output of UN12733
BLASTX 7.6.2 Query= UN12733 /QuerySize=265 (264 letters) Database: Uniprot/SwissProt; 537,505 sequences; 190,795,139 total letters Score E Sequences producing significant alignments: (bits) Value sp|F4IN69|MD33B_ARATH Mediator of RNA polymerase II transcriptio... 60 4e-009 >sp|F4IN69|MD33B_ARATH Mediator of RNA polymerase II transcription subunit 33B OS=Arabidopsis thaliana GN=MED33B PE=1 SV=1 Length = 1275 Score = 60 bits (143), Expect = 4e-009 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = +2 Query: 8 HLSQRSSILSKEPGLLLVEFVFAIVWQLLDASLDDEGMLDLLPNK 142 HLS+ + +EPG +L+ FVF+IVW+LLDASLD+EG+L+L NK Sbjct: 140 HLSETFGVQDQEPGSILLAFVFSIVWELLDASLDEEGLLELTSNK 184 Database: Uniprot/SwissProt Posted date: Thu Sep 27 17:53:50 2012 Number of letters in database: 190,795,139 Number of sequences in database: 537,505 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,485,920,910 Number of Sequences: 537505 Number of Extensions: 32485920910 Number of Successful Extensions: 192549695 Number of sequences better than 0.0: 0 |