GenBank blast output of UN12733
BLASTX 7.6.2 Query= UN12733 /QuerySize=265 (264 letters) Database: GenBank nr; 20,571,509 sequences; 7,061,663,739 total letters Score E Sequences producing significant alignments: (bits) Value gi|255551487|ref|XP_002516789.1| conserved hypothetical protein ... 66 2e-009 gi|296086711|emb|CBI32346.3| unnamed protein product [Vitis vini... 64 8e-009 gi|359479864|ref|XP_002271735.2| PREDICTED: uncharacterized prot... 64 8e-009 gi|356557874|ref|XP_003547235.1| PREDICTED: uncharacterized prot... 64 1e-008 gi|356549015|ref|XP_003542894.1| PREDICTED: uncharacterized prot... 63 1e-008 gi|224068803|ref|XP_002302829.1| predicted protein [Populus tric... 62 3e-008 gi|224128668|ref|XP_002320389.1| predicted protein [Populus tric... 61 5e-008 gi|20197556|gb|AAD13716.3| unknown protein [Arabidopsis thaliana] 60 1e-007 gi|240254676|ref|NP_566125.4| reduced epidermal fluorescence 4 p... 60 1e-007 gi|297824921|ref|XP_002880343.1| structural constituent of ribos... 59 2e-007 >gi|255551487|ref|XP_002516789.1| conserved hypothetical protein [Ricinus communis] Length = 1325 Score = 66 bits (159), Expect = 2e-009 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = +2 Query: 8 HLSQRSSILSKEPGLLLVEFVFAIVWQLLDASLDDEGMLDLLPNK 142 HLSQ + + +PG+L+VEF+F+IVWQLLDASLDDEG+L+L P + Sbjct: 139 HLSQNFGLQASDPGILVVEFIFSIVWQLLDASLDDEGLLELTPEE 183 >gi|296086711|emb|CBI32346.3| unnamed protein product [Vitis vinifera] Length = 1388 Score = 64 bits (154), Expect = 8e-009 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = +2 Query: 8 HLSQRSSILSKEPGLLLVEFVFAIVWQLLDASLDDEGMLDLLPNK 142 HLSQ + EPG L+VEF+F+IVWQLLDASLDDEG+L+L P K Sbjct: 200 HLSQIFGLQVCEPGALVVEFIFSIVWQLLDASLDDEGLLELAPEK 244 >gi|359479864|ref|XP_002271735.2| PREDICTED: uncharacterized protein LOC100254459 [Vitis vinifera] Length = 1321 Score = 64 bits (154), Expect = 8e-009 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = +2 Query: 8 HLSQRSSILSKEPGLLLVEFVFAIVWQLLDASLDDEGMLDLLPNK 142 HLSQ + EPG L+VEF+F+IVWQLLDASLDDEG+L+L P K Sbjct: 149 HLSQIFGLQVCEPGALVVEFIFSIVWQLLDASLDDEGLLELAPEK 193 >gi|356557874|ref|XP_003547235.1| PREDICTED: uncharacterized protein LOC100782680 [Glycine max] Length = 1310 Score = 64 bits (153), Expect = 1e-008 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = +2 Query: 8 HLSQRSSILSKEPGLLLVEFVFAIVWQLLDASLDDEGMLDLLPNK 142 HLS + EPG+L+VEF+F+IVWQLLDASLDDEG+L+ P+K Sbjct: 124 HLSNIFGMSQSEPGILVVEFIFSIVWQLLDASLDDEGLLEFTPDK 168 >gi|356549015|ref|XP_003542894.1| PREDICTED: uncharacterized protein LOC100812937 [Glycine max] Length = 1305 Score = 63 bits (152), Expect = 1e-008 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = +2 Query: 8 HLSQRSSILSKEPGLLLVEFVFAIVWQLLDASLDDEGMLDLLPNK 142 HLS + EPG+L+VEF+F+IVWQLLDASLDDEG+L+ P+K Sbjct: 136 HLSNIFGMPQSEPGILVVEFIFSIVWQLLDASLDDEGLLEFTPDK 180 >gi|224068803|ref|XP_002302829.1| predicted protein [Populus trichocarpa] Length = 1295 Score = 62 bits (149), Expect = 3e-008 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +2 Query: 8 HLSQRSSILSKEPGLLLVEFVFAIVWQLLDASLDDEGMLDL 130 HLSQ + EPG LLVEFVF+IVWQLLDASLDDEG+L+L Sbjct: 154 HLSQIFGVQLCEPGFLLVEFVFSIVWQLLDASLDDEGLLEL 194 >gi|224128668|ref|XP_002320389.1| predicted protein [Populus trichocarpa] Length = 1315 Score = 61 bits (147), Expect = 5e-008 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = +2 Query: 8 HLSQRSSILSKEPGLLLVEFVFAIVWQLLDASLDDEGMLD 127 HLSQ + EPG+LLVEFVF+IVWQLLDASLDDEG+L+ Sbjct: 123 HLSQIFGVQLCEPGILLVEFVFSIVWQLLDASLDDEGLLE 162 >gi|20197556|gb|AAD13716.3| unknown protein [Arabidopsis thaliana] Length = 944 Score = 60 bits (143), Expect = 1e-007 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = +2 Query: 8 HLSQRSSILSKEPGLLLVEFVFAIVWQLLDASLDDEGMLDLLPNK 142 HLS+ + +EPG +L+ FVF+IVW+LLDASLD+EG+L+L NK Sbjct: 140 HLSETFGVQDQEPGSILLAFVFSIVWELLDASLDEEGLLELTSNK 184 >gi|240254676|ref|NP_566125.4| reduced epidermal fluorescence 4 protein [Arabidopsis thaliana] Length = 1275 Score = 60 bits (143), Expect = 1e-007 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = +2 Query: 8 HLSQRSSILSKEPGLLLVEFVFAIVWQLLDASLDDEGMLDLLPNK 142 HLS+ + +EPG +L+ FVF+IVW+LLDASLD+EG+L+L NK Sbjct: 140 HLSETFGVQDQEPGSILLAFVFSIVWELLDASLDEEGLLELTSNK 184 >gi|297824921|ref|XP_002880343.1| structural constituent of ribosome [Arabidopsis lyrata subsp. lyrata] Length = 1297 Score = 59 bits (142), Expect = 2e-007 Identities = 25/45 (55%), Positives = 36/45 (80%) Frame = +2 Query: 8 HLSQRSSILSKEPGLLLVEFVFAIVWQLLDASLDDEGMLDLLPNK 142 HLS+ + +EPG +L+ FVF+I+WQL+DASLD+EG+L+L NK Sbjct: 142 HLSETFGVQDQEPGSILLAFVFSIIWQLVDASLDEEGLLELTSNK 186 Database: GenBank nr Posted date: Thu Sep 27 19:07:00 2012 Number of letters in database: 7,061,663,739 Number of sequences in database: 20,571,509 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,203,784,667,512 Number of Sequences: 20571509 Number of Extensions: 1203784667512 Number of Successful Extensions: 538869598 Number of sequences better than 0.0: 0 |