GenBank blast output of UN05381
BLASTX 7.6.2 Query= UN05381 /QuerySize=1132 (1131 letters) Database: GenBank nr; 20,571,509 sequences; 7,061,663,739 total letters Score E Sequences producing significant alignments: (bits) Value gi|87299439|dbj|BAE79552.1| phytoene desaturase [Chrysanthemum x... 62 2e-007 gi|219814635|gb|ACL36586.1| phytoene desaturase [Triticum aestivum] 62 2e-007 gi|231274746|emb|CAX36913.1| phytoene desaturase enzyme [Triticu... 62 2e-007 gi|15236439|ref|NP_193157.1| phytoene dehydrogenase [Arabidopsis... 60 6e-007 gi|42572897|ref|NP_974545.1| phytoene dehydrogenase [Arabidopsis... 60 6e-007 gi|16323131|gb|AAL15300.1| AT4g14210/dl3145c [Arabidopsis thaliana] 60 6e-007 gi|297800838|ref|XP_002868303.1| AT4g14210/dl3145c [Arabidopsis ... 60 6e-007 gi|326507422|dbj|BAK03104.1| predicted protein [Hordeum vulgare ... 60 8e-007 gi|357113728|ref|XP_003558653.1| PREDICTED: phytoene dehydrogena... 60 8e-007 gi|157381267|gb|ABV46593.1| phytoene desaturase [Brassica olerac... 59 1e-006 >gi|87299439|dbj|BAE79552.1| phytoene desaturase [Chrysanthemum x morifolium] Length = 572 Score = 62 bits (150), Expect = 2e-007 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -1 Query: 135 PVEGFYLDGDYTKQKYLASMEGAFL*EIFCAQDIVQ 28 P+EGFYL GDYTKQKYLASMEGA L E FCAQ IVQ Sbjct: 519 PIEGFYLAGDYTKQKYLASMEGAVLSEKFCAQAIVQ 554 >gi|219814635|gb|ACL36586.1| phytoene desaturase [Triticum aestivum] Length = 576 Score = 62 bits (150), Expect = 2e-007 Identities = 31/42 (73%), Positives = 33/42 (78%) Frame = -1 Query: 135 PVEGFYLDGDYTKQKYLASMEGAFL*EIFCAQDIVQLGKSLA 10 P+EGFYL GDYTKQKYLASMEGA L FCAQ IVQ K L+ Sbjct: 518 PIEGFYLAGDYTKQKYLASMEGAVLSGKFCAQSIVQDSKMLS 559 >gi|231274746|emb|CAX36913.1| phytoene desaturase enzyme [Triticum aestivum] Length = 576 Score = 62 bits (150), Expect = 2e-007 Identities = 31/42 (73%), Positives = 33/42 (78%) Frame = -1 Query: 135 PVEGFYLDGDYTKQKYLASMEGAFL*EIFCAQDIVQLGKSLA 10 P+EGFYL GDYTKQKYLASMEGA L FCAQ IVQ K L+ Sbjct: 518 PIEGFYLAGDYTKQKYLASMEGAVLSGKFCAQSIVQDSKMLS 559 >gi|15236439|ref|NP_193157.1| phytoene dehydrogenase [Arabidopsis thaliana] Length = 566 Score = 60 bits (145), Expect = 6e-007 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = -1 Query: 135 PVEGFYLDGDYTKQKYLASMEGAFL*EIFCAQDIVQLGKSLAES 4 P+EGFYL GDYTKQKYLASMEGA L FC+Q IVQ + LA S Sbjct: 510 PIEGFYLAGDYTKQKYLASMEGAVLSGKFCSQSIVQDYELLAAS 553 >gi|42572897|ref|NP_974545.1| phytoene dehydrogenase [Arabidopsis thaliana] Length = 566 Score = 60 bits (145), Expect = 6e-007 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = -1 Query: 135 PVEGFYLDGDYTKQKYLASMEGAFL*EIFCAQDIVQLGKSLAES 4 P+EGFYL GDYTKQKYLASMEGA L FC+Q IVQ + LA S Sbjct: 510 PIEGFYLAGDYTKQKYLASMEGAVLSGKFCSQSIVQDYELLAAS 553 >gi|16323131|gb|AAL15300.1| AT4g14210/dl3145c [Arabidopsis thaliana] Length = 566 Score = 60 bits (145), Expect = 6e-007 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = -1 Query: 135 PVEGFYLDGDYTKQKYLASMEGAFL*EIFCAQDIVQLGKSLAES 4 P+EGFYL GDYTKQKYLASMEGA L FC+Q IVQ + LA S Sbjct: 510 PIEGFYLAGDYTKQKYLASMEGAVLSGKFCSQSIVQDYELLAAS 553 >gi|297800838|ref|XP_002868303.1| AT4g14210/dl3145c [Arabidopsis lyrata subsp. lyrata] Length = 569 Score = 60 bits (145), Expect = 6e-007 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = -1 Query: 135 PVEGFYLDGDYTKQKYLASMEGAFL*EIFCAQDIVQLGKSLAES 4 P+EGFYL GDYTKQKYLASMEGA L FC+Q IVQ + LA S Sbjct: 511 PIEGFYLAGDYTKQKYLASMEGAVLSGKFCSQSIVQDYELLAAS 554 >gi|326507422|dbj|BAK03104.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 565 Score = 60 bits (144), Expect = 8e-007 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = -1 Query: 135 PVEGFYLDGDYTKQKYLASMEGAFL*EIFCAQDIVQLGKSLA 10 P+EGFYL GDYTKQKYLASMEGA L CAQ IVQ K L+ Sbjct: 507 PIEGFYLAGDYTKQKYLASMEGAVLSGKLCAQSIVQDSKMLS 548 >gi|357113728|ref|XP_003558653.1| PREDICTED: phytoene dehydrogenase, chloroplastic/chromoplastic-like [Brachypodium distachyon] Length = 578 Score = 60 bits (144), Expect = 8e-007 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = -1 Query: 135 PVEGFYLDGDYTKQKYLASMEGAFL*EIFCAQDIVQLGKSLA 10 P+EGFYL GDYTKQKYLASMEGA L CAQ IVQ K L+ Sbjct: 522 PIEGFYLAGDYTKQKYLASMEGAVLSGKLCAQSIVQDSKMLS 563 >gi|157381267|gb|ABV46593.1| phytoene desaturase [Brassica oleracea var. botrytis] Length = 563 Score = 59 bits (142), Expect = 1e-006 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -1 Query: 135 PVEGFYLDGDYTKQKYLASMEGAFL*EIFCAQDIVQLGKSLAES 4 P++GFYL GDYTKQKYLASMEGA L FC+Q IVQ + LA S Sbjct: 508 PIQGFYLAGDYTKQKYLASMEGAVLSGKFCSQSIVQDYELLAAS 551 Database: GenBank nr Posted date: Thu Sep 27 19:07:00 2012 Number of letters in database: 7,061,663,739 Number of sequences in database: 20,571,509 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 584,074,321,054 Number of Sequences: 20571509 Number of Extensions: 584074321054 Number of Successful Extensions: 378460450 Number of sequences better than 0.0: 0 |