Arabidopsis blast output of UN05381
BLASTX 7.6.2 Query= UN05381 /QuerySize=1132 (1131 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G14210.1 | Symbols: PDS3, PDS, PDE226 | PDS3 (... 60 2e-009 TAIR9_protein||AT4G14210.2 | Symbols: PDS3, PDS, PDE226 | PDS3 (... 60 2e-009 >TAIR9_protein||AT4G14210.1 | Symbols: PDS3, PDS, PDE226 | PDS3 (PHYTOENE DESATURASE 3); phytoene dehydrogenase | chr4:8190426-8194769 REVERSE Length = 567 Score = 60 bits (145), Expect = 2e-009 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = -1 Query: 135 PVEGFYLDGDYTKQKYLASMEGAFL*EIFCAQDIVQLGKSLAES 4 P+EGFYL GDYTKQKYLASMEGA L FC+Q IVQ + LA S Sbjct: 510 PIEGFYLAGDYTKQKYLASMEGAVLSGKFCSQSIVQDYELLAAS 553 >TAIR9_protein||AT4G14210.2 | Symbols: PDS3, PDS, PDE226 | PDS3 (PHYTOENE DESATURASE 3); phytoene dehydrogenase | chr4:8190426-8194769 REVERSE Length = 567 Score = 60 bits (145), Expect = 2e-009 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = -1 Query: 135 PVEGFYLDGDYTKQKYLASMEGAFL*EIFCAQDIVQLGKSLAES 4 P+EGFYL GDYTKQKYLASMEGA L FC+Q IVQ + LA S Sbjct: 510 PIEGFYLAGDYTKQKYLASMEGAVLSGKFCSQSIVQDYELLAAS 553 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,405,297,440 Number of Sequences: 33410 Number of Extensions: 2405297440 Number of Successful Extensions: 111619934 Number of sequences better than 0.0: 0 |